PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peinf101Scf00665g08033.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia; Petunia integrifolia
Family STAT
Protein Properties Length: 740aa    MW: 83501.9 Da    PI: 6.2397
Description STAT family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peinf101Scf00665g08033.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1STAT1872.3e-582193381120
                      STAT   1 ldvvllnalgqpvekdvevvasLlyadsglvveksddaeapLLisydGvefssedrplkllrGrasfklkisqLsskcdnrLfri 85 
                               ldv+l++ +++p++ +vevvasL+yad+ ++v ksdd+eapLL+sydG+e++s+drp+k++ GrasfklkisqLsskcdnrLfri
  Peinf101Scf00665g08033.1 219 LDVTLMDNFSRPMTEEVEVVASLVYADNEAPVGKSDDDEAPLLTSYDGIEYASSDRPSKVISGRASFKLKISQLSSKCDNRLFRI 303
                               89*********************************************************************************** PP

                      STAT  86 kfeipklkkypfleavskpirCisrsrntrssslt 120
                               +f+ipk+ kypfl ++s+p+rCisr+rn+r++sl+
  Peinf101Scf00665g08033.1 304 RFDIPKMGKYPFLVVLSRPVRCISRNRNVRATSLM 338
                               ******************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF498991.45E-710140IPR013320Concanavalin A-like lectin/glucanase domain
SuperFamilySSF555501.9E-8639703IPR000980SH2 domain
Gene3DG3DSA:3.30.505.102.5E-6639704IPR000980SH2 domain
PROSITE profilePS500019.885641723IPR000980SH2 domain
Sequence ? help Back to Top
Protein Sequence    Length: 740 aa     Download sequence    Send to blast
KGEKGIMGFQ DYVFLKDLQV EFKDYEETNG FILCFWFFLN EASTLPSTIL HQEHPDVTAH  60
VPFLLLDEKK RMLLFPLQCS SHLNVTSWRE VTYAASLSEF PTKRWVHIGC EVRHDFLRLY  120
LDGEIVGEKA LTSSINNDLG SDSSRISLTC ISGKDSQLDG YAHSAVLLPI VSSIKGHYVK  180
DPPVQLSIDS SSAYEIEEDT DGVWSIVSGK ASCRRNFSLD VTLMDNFSRP MTEEVEVVAS  240
LVYADNEAPV GKSDDDEAPL LTSYDGIEYA SSDRPSKVIS GRASFKLKIS QLSSKCDNRL  300
FRIRFDIPKM GKYPFLVVLS RPVRCISRNR NVRATSLMLR KSSLGTHLLD GSQSPELEDG  360
SSDLLPCIVR EAKPSPSSKR VKLGQEKLCA NFKDDFVLKQ ANGESKSHSW TSEDNYAYRN  420
ALVARPVIHG GAENFSSDSE NSETTNLVLD DLPSNRDPIS DLAVFKYCLG DLNERRLLLK  480
EMAMTARQEE LAAFGERVSL FSGCSHHRHQ ISISKRLIEE GIKCWNLISN DNDHVLWDTL  540
VCGLQEHFLN TTFGCNRSLT LQVHFFLSKL AYCLKNYFKE LFRDNFALIP SDFSLLRRVA  600
GCQDLVSQDN FEKLWCWLYP VAFTLSQQCI TSLWVSRSPL WIEGFITKEE AESSLRGLGA  660
LQDPGTFVLR FPTSRSWPHP DAGNLVVTYV GSDCNIHHRL LSLDFIYSSG AKGMMVKSMQ  720
DMLLEQPELR RLGRQGHTPF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2103541e-121AC210354.1 Solanum lycopersicum cultivar Heinz 1706 chromosome 7 clone C07HBa0102J11, complete sequence.
GenBankHG9755191e-121HG975519.1 Solanum lycopersicum chromosome ch07, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006348345.10.0PREDICTED: uncharacterized protein LOC102592228
TrEMBLA0A0V0INF70.0A0A0V0INF7_SOLCH; Putative ovule protein
STRINGSolyc07g062050.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA93942325
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17040.10.0SH2 domain protein A